Brand: | Abnova |
Reference: | H00025833-M02 |
Product name: | POU2F3 monoclonal antibody (M02), clone 6D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU2F3. |
Clone: | 6D1 |
Isotype: | IgG2a Kappa |
Gene id: | 25833 |
Gene name: | POU2F3 |
Gene alias: | Epoc-1|FLJ40063|MGC126698|OCT11|PLA-1|Skn-1a |
Gene description: | POU class 2 homeobox 3 |
Genbank accession: | NM_014352 |
Immunogen: | POU2F3 (NP_055167, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQ |
Protein accession: | NP_055167 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |