SULT4A1 (Human) Recombinant Protein (P01) View larger

SULT4A1 (Human) Recombinant Protein (P01)

H00025830-P01_2ug

New product

279,00 € tax excl.

2 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULT4A1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SULT4A1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00025830-P01
Product name: SULT4A1 (Human) Recombinant Protein (P01)
Product description: Human SULT4A1 full-length ORF ( AAH22459, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 25830
Gene name: SULT4A1
Gene alias: BR-STL-1|BRSTL1|DJ388M5.3|MGC40032|NST|SULTX3|hBR-STL-1
Gene description: sulfotransferase family 4A, member 1
Genbank accession: BC022459
Immunogen sequence/protein sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQPARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Protein accession: AAH22459
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00025830-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SULT4A1 (Human) Recombinant Protein (P01) now

Add to cart