PRDX5 monoclonal antibody (M01), clone 3E6 View larger

PRDX5 monoclonal antibody (M01), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRDX5 monoclonal antibody (M01), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PRDX5 monoclonal antibody (M01), clone 3E6

Brand: Abnova
Reference: H00025824-M01
Product name: PRDX5 monoclonal antibody (M01), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant PRDX5.
Clone: 3E6
Isotype: IgG2a Kappa
Gene id: 25824
Gene name: PRDX5
Gene alias: ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene description: peroxiredoxin 5
Genbank accession: NM_012094
Immunogen: PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Protein accession: NP_036226
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025824-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PRDX5 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PRDX5 monoclonal antibody (M01), clone 3E6 now

Add to cart