KLK5 monoclonal antibody (M01), clone 3H3 View larger

KLK5 monoclonal antibody (M01), clone 3H3

H00025818-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK5 monoclonal antibody (M01), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about KLK5 monoclonal antibody (M01), clone 3H3

Brand: Abnova
Reference: H00025818-M01
Product name: KLK5 monoclonal antibody (M01), clone 3H3
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK5.
Clone: 3H3
Isotype: IgG2a Kappa
Gene id: 25818
Gene name: KLK5
Gene alias: KLK-L2|KLKL2|SCTE
Gene description: kallikrein-related peptidase 5
Genbank accession: NM_012427
Immunogen: KLK5 (NP_036559, 194 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Protein accession: NP_036559
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025818-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged KLK5 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy KLK5 monoclonal antibody (M01), clone 3H3 now

Add to cart