Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00025805-M01 |
Product name: | BAMBI monoclonal antibody (M01), clone 3C1-1D1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant BAMBI. |
Clone: | 3C1-1D1 |
Isotype: | IgG1 kappa |
Gene id: | 25805 |
Gene name: | BAMBI |
Gene alias: | NMA |
Gene description: | BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) |
Genbank accession: | BC019252 |
Immunogen: | BAMBI (AAH19252, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV |
Protein accession: | AAH19252 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (54.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BAMBI expression in transfected 293T cell line by BAMBI monoclonal antibody (M01), clone 3C1-1D1. Lane 1: BAMBI transfected lysate(29.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Human trabecular meshwork cells express BMP antagonist mRNAs and proteins.Tovar-Vidales T, Fitzgerald AM, Clark AF. Exp Eye Res. 2016 May 7. [Epub ahead of print] |