SPDEF monoclonal antibody (M01), clone 4A5 View larger

SPDEF monoclonal antibody (M01), clone 4A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPDEF monoclonal antibody (M01), clone 4A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SPDEF monoclonal antibody (M01), clone 4A5

Brand: Abnova
Reference: H00025803-M01
Product name: SPDEF monoclonal antibody (M01), clone 4A5
Product description: Mouse monoclonal antibody raised against a partial recombinant SPDEF.
Clone: 4A5
Isotype: IgG2b Kappa
Gene id: 25803
Gene name: SPDEF
Gene alias: PDEF|RP11-375E1__A.3|bA375E1.3
Gene description: SAM pointed domain containing ets transcription factor
Genbank accession: NM_012391
Immunogen: SPDEF (NP_036523, 92 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD
Protein accession: NP_036523
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025803-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025803-M01-13-15-1.jpg
Application image note: Western Blot analysis of SPDEF expression in transfected 293T cell line by SPDEF monoclonal antibody (M01), clone 4A5.

Lane 1: SPDEF transfected lysate(37.518 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPDEF monoclonal antibody (M01), clone 4A5 now

Add to cart