QPCT monoclonal antibody (M02), clone 3G2 View larger

QPCT monoclonal antibody (M02), clone 3G2

H00025797-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of QPCT monoclonal antibody (M02), clone 3G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA

More info about QPCT monoclonal antibody (M02), clone 3G2

Brand: Abnova
Reference: H00025797-M02
Product name: QPCT monoclonal antibody (M02), clone 3G2
Product description: Mouse monoclonal antibody raised against a partial recombinant QPCT.
Clone: 3G2
Isotype: IgG2b Kappa
Gene id: 25797
Gene name: QPCT
Gene alias: GCT|QC
Gene description: glutaminyl-peptide cyclotransferase
Genbank accession: NM_012413
Immunogen: QPCT (NP_036545, 262 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Protein accession: NP_036545
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025797-M02-3-31-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy QPCT monoclonal antibody (M02), clone 3G2 now

Add to cart