Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00025797-D01P |
Product name: | QPCT purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human QPCT protein. |
Gene id: | 25797 |
Gene name: | QPCT |
Gene alias: | GCT|QC |
Gene description: | glutaminyl-peptide cyclotransferase |
Genbank accession: | NM_012413 |
Immunogen: | QPCT (NP_036545.1, 1 a.a. ~ 361 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL |
Protein accession: | NP_036545.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of QPCT expression in transfected 293T cell line (H00025797-T02) by QPCT MaxPab polyclonal antibody. Lane 1: QPCT transfected lysate(40.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Glutaminyl Cyclase As a Diagnostic/Prognostic Indicator For Neurodegenrative Diseases.Demuth H, Schilling S, Kleinschmidt M, Rahfeld J, Kehlen A, Bornack M. United States Patent Application. 2015 Sept. US20150241452A1 |