Brand: | Abnova |
Reference: | H00025788-M01 |
Product name: | RAD54B monoclonal antibody (M01), clone 4A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD54B. |
Clone: | 4A7 |
Isotype: | IgG1 Kappa |
Gene id: | 25788 |
Gene name: | RAD54B |
Gene alias: | FSBP|RDH54 |
Gene description: | RAD54 homolog B (S. cerevisiae) |
Genbank accession: | BC001965 |
Immunogen: | RAD54B (AAH01965, 801 a.a. ~ 910 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT |
Protein accession: | AAH01965 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RAD54B on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |