RASGRP3 polyclonal antibody (A01) View larger

RASGRP3 polyclonal antibody (A01)

H00025780-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RASGRP3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RASGRP3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00025780-A01
Product name: RASGRP3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RASGRP3.
Gene id: 25780
Gene name: RASGRP3
Gene alias: GRP3|KIAA0846
Gene description: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Genbank accession: BC027849
Immunogen: RASGRP3 (AAH27849, 581 a.a. ~ 690 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Protein accession: AAH27849
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025780-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025780-A01-1-25-1.jpg
Application image note: RASGRP3 polyclonal antibody (A01), Lot # UOH1051006QCS1 Western Blot analysis of RASGRP3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RASGRP3 polyclonal antibody (A01) now

Add to cart