Brand: | Abnova |
Reference: | H00025759-M01 |
Product name: | SHC2 monoclonal antibody (M01), clone 4A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SHC2. |
Clone: | 4A4 |
Isotype: | IgG2a Kappa |
Gene id: | 25759 |
Gene name: | SHC2 |
Gene alias: | SCK|SHCB|SLI |
Gene description: | SHC (Src homology 2 domain containing) transforming protein 2 |
Genbank accession: | XM_375550 |
Immunogen: | SHC2 (XP_375550, 718 a.a. ~ 829 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSP |
Protein accession: | XP_375550 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.06 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | SHC2 monoclonal antibody (M01), clone 4A4 Western Blot analysis of SHC2 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |