Cart 96 Product Products 37 639,21 € (empty)
No products
To be determined Shipping
37 639,21 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 96 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 639,21 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 639,21 €
Data sheet of CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00024146-D01P |
| Product name: | CLDN15 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CLDN15 protein. |
| Gene id: | 24146 |
| Gene name: | CLDN15 |
| Gene alias: | FLJ42715|MGC19536 |
| Gene description: | claudin 15 |
| Genbank accession: | NM_014343.1 |
| Immunogen: | CLDN15 (NP_055158.1, 1 a.a. ~ 228 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
| Protein accession: | NP_055158.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CLDN15 expression in transfected 293T cell line (H00024146-T02) by CLDN15 MaxPab polyclonal antibody. Lane 1: CLDN15 transfected lysate(24.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |