NAT6 MaxPab mouse polyclonal antibody (B01) View larger

NAT6 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAT6 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NAT6 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00024142-B01
Product name: NAT6 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NAT6 protein.
Gene id: 24142
Gene name: NAT6
Gene alias: FUS-2|FUS2
Gene description: N-acetyltransferase 6 (GCN5-related)
Genbank accession: BC004483
Immunogen: NAT6 (AAH04483, 23 a.a. ~ 308 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTGLTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPPKSLLETQYQNVRGRPIFWMEKDI
Protein accession: AAH04483
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00024142-B01-13-15-1.jpg
Application image note: Western Blot analysis of NAT6 expression in transfected 293T cell line (H00024142-T01) by NAT6 MaxPab polyclonal antibody.

Lane 1: NAT6 transfected lysate(33.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NAT6 MaxPab mouse polyclonal antibody (B01) now

Add to cart