OSBP2 monoclonal antibody (M10), clone 2B4 View larger

OSBP2 monoclonal antibody (M10), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBP2 monoclonal antibody (M10), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about OSBP2 monoclonal antibody (M10), clone 2B4

Brand: Abnova
Reference: H00023762-M10
Product name: OSBP2 monoclonal antibody (M10), clone 2B4
Product description: Mouse monoclonal antibody raised against a partial recombinant OSBP2.
Clone: 2B4
Isotype: IgG2a Kappa
Gene id: 23762
Gene name: OSBP2
Gene alias: ORP-4|ORP4|OSBPL1|OSBPL4
Gene description: oxysterol binding protein 2
Genbank accession: NM_030758
Immunogen: OSBP2 (NP_110385.1, 818 a.a. ~ 916 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF
Protein accession: NP_110385.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023762-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023762-M10-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged OSBP2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OSBP2 monoclonal antibody (M10), clone 2B4 now

Add to cart