BHMT2 monoclonal antibody (M02A), clone 1E8 View larger

BHMT2 monoclonal antibody (M02A), clone 1E8

H00023743-M02A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BHMT2 monoclonal antibody (M02A), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about BHMT2 monoclonal antibody (M02A), clone 1E8

Brand: Abnova
Reference: H00023743-M02A
Product name: BHMT2 monoclonal antibody (M02A), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant BHMT2.
Clone: 1E8
Isotype: IgM Kappa
Gene id: 23743
Gene name: BHMT2
Gene alias: FLJ20001
Gene description: betaine-homocysteine methyltransferase 2
Genbank accession: NM_017614
Immunogen: BHMT2 (NP_060084, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA
Protein accession: NP_060084
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023743-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BHMT2 monoclonal antibody (M02A), clone 1E8 now

Add to cart