CRI1 purified MaxPab mouse polyclonal antibody (B01P) View larger

CRI1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRI1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about CRI1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023741-B01P
Product name: CRI1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CRI1 protein.
Gene id: 23741
Gene name: EID1
Gene alias: C15orf3|CRI1|EID-1|IRO45620|MGC138883|MGC138884|PNAS-22|PTD014|RBP21
Gene description: EP300 interacting inhibitor of differentiation 1
Genbank accession: NM_014335.2
Immunogen: CRI1 (NP_055150.1, 1 a.a. ~ 187 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Protein accession: NP_055150.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023741-B01P-13-15-1.jpg
Application image note: Western Blot analysis of EID1 expression in transfected 293T cell line (H00023741-T01) by EID1 MaxPab polyclonal antibody.

Lane 1: CRI1 transfected lysate(20.57 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CRI1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart