Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CADM1 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about CADM1 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00023705-Q01 |
| Product name: | CADM1 (Human) Recombinant Protein (Q01) |
| Product description: | Human CADM1 partial ORF ( NP_055148, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 23705 |
| Gene name: | CADM1 |
| Gene alias: | BL2|DKFZp686F1789|IGSF4|IGSF4A|MGC149785|MGC51880|NECL2|Necl-2|RA175|ST17|SYNCAM|TSLC1|sTSLC-1|sgIGSF|synCAM1 |
| Gene description: | cell adhesion molecule 1 |
| Genbank accession: | NM_014333 |
| Immunogen sequence/protein sequence: | IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT |
| Protein accession: | NP_055148 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cell adhesion molecule 1(CADM1): a novel risk factor for venous thrombosis.Hasstedt SJ, Bezemer ID, Callas PW, Vossen CY, Trotman W, Hebbel RP, Demers C, Rosendaal FR, Bovill EG. Blood. 2009 Oct 1;114(14):3084-91. Epub 2009 Jul 30. |