Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CADM1 monoclonal antibody (M09), clone 3F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA |
More info about CADM1 monoclonal antibody (M09), clone 3F6
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CADM1. |
| Clone: | 3F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23705 |
| Gene name: | CADM1 |
| Gene alias: | BL2|DKFZp686F1789|IGSF4|IGSF4A|MGC149785|MGC51880|NECL2|Necl-2|RA175|ST17|SYNCAM|TSLC1|sTSLC-1|sgIGSF|synCAM1 |
| Gene description: | cell adhesion molecule 1 |
| Genbank accession: | NM_014333 |
| Immunogen: | CADM1 (NP_055148, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT |
| Protein accession: | NP_055148 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |