SGKL monoclonal antibody (M02), clone 2A7 View larger

SGKL monoclonal antibody (M02), clone 2A7

H00023678-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SGKL monoclonal antibody (M02), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about SGKL monoclonal antibody (M02), clone 2A7

Brand: Abnova
Reference: H00023678-M02
Product name: SGKL monoclonal antibody (M02), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant SGKL.
Clone: 2A7
Isotype: IgG2b Kappa
Gene id: 23678
Gene name: SGK3
Gene alias: CISK|DKFZp781N0293|SGK2|SGKL
Gene description: serum/glucocorticoid regulated kinase family, member 3
Genbank accession: BC015326
Immunogen: SGKL (AAH15326, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE
Protein accession: AAH15326
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023678-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.93 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023678-M02-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SGK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SGKL monoclonal antibody (M02), clone 2A7 now

Add to cart