SH3BP4 monoclonal antibody (M01), clone 3F3 View larger

SH3BP4 monoclonal antibody (M01), clone 3F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3BP4 monoclonal antibody (M01), clone 3F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SH3BP4 monoclonal antibody (M01), clone 3F3

Brand: Abnova
Reference: H00023677-M01
Product name: SH3BP4 monoclonal antibody (M01), clone 3F3
Product description: Mouse monoclonal antibody raised against a partial recombinant SH3BP4.
Clone: 3F3
Isotype: IgG1 Kappa
Gene id: 23677
Gene name: SH3BP4
Gene alias: BOG25|TTP
Gene description: SH3-domain binding protein 4
Genbank accession: BC057396
Immunogen: SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ
Protein accession: AAH57396
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023677-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023677-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SH3BP4 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SH3BP4 monoclonal antibody (M01), clone 3F3 now

Add to cart