Brand: | Abnova |
Reference: | H00023677-A01 |
Product name: | SH3BP4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SH3BP4. |
Gene id: | 23677 |
Gene name: | SH3BP4 |
Gene alias: | BOG25|TTP |
Gene description: | SH3-domain binding protein 4 |
Genbank accession: | BC057396 |
Immunogen: | SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ |
Protein accession: | AAH57396 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SH3BP4 polyclonal antibody (A01), Lot # 051003JC01 Western Blot analysis of SH3BP4 expression in U-2 OS ( Cat # L022V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |