Brand: | Abnova |
Reference: | H00023673-M01 |
Product name: | STX12 monoclonal antibody (M01), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STX12. |
Clone: | 3B9 |
Isotype: | IgG2a Kappa |
Gene id: | 23673 |
Gene name: | STX12 |
Gene alias: | MGC51957|STX13|STX14 |
Gene description: | syntaxin 12 |
Genbank accession: | NM_177424 |
Immunogen: | STX12 (NP_803173, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLA |
Protein accession: | NP_803173 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged STX12 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |