STX12 monoclonal antibody (M01), clone 3B9 View larger

STX12 monoclonal antibody (M01), clone 3B9

H00023673-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STX12 monoclonal antibody (M01), clone 3B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about STX12 monoclonal antibody (M01), clone 3B9

Brand: Abnova
Reference: H00023673-M01
Product name: STX12 monoclonal antibody (M01), clone 3B9
Product description: Mouse monoclonal antibody raised against a partial recombinant STX12.
Clone: 3B9
Isotype: IgG2a Kappa
Gene id: 23673
Gene name: STX12
Gene alias: MGC51957|STX13|STX14
Gene description: syntaxin 12
Genbank accession: NM_177424
Immunogen: STX12 (NP_803173, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLA
Protein accession: NP_803173
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023673-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023673-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged STX12 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy STX12 monoclonal antibody (M01), clone 3B9 now

Add to cart