PLXNB2 polyclonal antibody (A01) View larger

PLXNB2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLXNB2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PLXNB2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00023654-A01
Product name: PLXNB2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PLXNB2.
Gene id: 23654
Gene name: PLXNB2
Gene alias: KIAA0315|MM1|Nbla00445|PLEXB2|dJ402G11.3
Gene description: plexin B2
Genbank accession: XM_371474
Immunogen: PLXNB2 (XP_371474, 1506 a.a. ~ 1611 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPE
Protein accession: XP_371474
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023654-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLXNB2 polyclonal antibody (A01) now

Add to cart