H00023617-M02A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023617-M02A |
Product name: | TSSK2 monoclonal antibody (M02A), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK2. |
Clone: | 1H2 |
Isotype: | IgG2b Kappa |
Gene id: | 23617 |
Gene name: | TSSK2 |
Gene alias: | DGS-G|FLJ38613|SPOGA2|STK22B |
Gene description: | testis-specific serine kinase 2 |
Genbank accession: | BC037781 |
Immunogen: | TSSK2 (AAH37781, 265 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST |
Protein accession: | AAH37781 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TSSK2 monoclonal antibody (M02A), clone 1H2 Western Blot analysis of TSSK2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |