TSSK2 monoclonal antibody (M02A), clone 1H2 View larger

TSSK2 monoclonal antibody (M02A), clone 1H2

H00023617-M02A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSSK2 monoclonal antibody (M02A), clone 1H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TSSK2 monoclonal antibody (M02A), clone 1H2

Brand: Abnova
Reference: H00023617-M02A
Product name: TSSK2 monoclonal antibody (M02A), clone 1H2
Product description: Mouse monoclonal antibody raised against a partial recombinant TSSK2.
Clone: 1H2
Isotype: IgG2b Kappa
Gene id: 23617
Gene name: TSSK2
Gene alias: DGS-G|FLJ38613|SPOGA2|STK22B
Gene description: testis-specific serine kinase 2
Genbank accession: BC037781
Immunogen: TSSK2 (AAH37781, 265 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST
Protein accession: AAH37781
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023617-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023617-M02A-1-1-1.jpg
Application image note: TSSK2 monoclonal antibody (M02A), clone 1H2 Western Blot analysis of TSSK2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSSK2 monoclonal antibody (M02A), clone 1H2 now

Add to cart