PATZ1 monoclonal antibody (M01), clone 1B2 View larger

PATZ1 monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PATZ1 monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PATZ1 monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00023598-M01
Product name: PATZ1 monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant PATZ1.
Clone: 1B2
Isotype: IgG2b Kappa
Gene id: 23598
Gene name: PATZ1
Gene alias: MAZR|PATZ|RIAZ|ZBTB19|ZNF278|ZSG|dJ400N23
Gene description: POZ (BTB) and AT hook containing zinc finger 1
Genbank accession: NM_032051
Immunogen: PATZ1 (NP_114440.1, 260 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACE
Protein accession: NP_114440.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023598-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023598-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PATZ1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PATZ1 monoclonal antibody (M01), clone 1B2 now

Add to cart