ORC3L monoclonal antibody (M04), clone 1G1 View larger

ORC3L monoclonal antibody (M04), clone 1G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ORC3L monoclonal antibody (M04), clone 1G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ORC3L monoclonal antibody (M04), clone 1G1

Brand: Abnova
Reference: H00023595-M04
Product name: ORC3L monoclonal antibody (M04), clone 1G1
Product description: Mouse monoclonal antibody raised against a partial recombinant ORC3L.
Clone: 1G1
Isotype: IgG2b Kappa
Gene id: 23595
Gene name: ORC3L
Gene alias: LAT|LATHEO|ORC3
Gene description: origin recognition complex, subunit 3-like (yeast)
Genbank accession: BC035494
Immunogen: ORC3L (AAH35494, 602 a.a. ~ 711 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
Protein accession: AAH35494
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023595-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ORC3L is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ORC3L monoclonal antibody (M04), clone 1G1 now

Add to cart