SMUG1 monoclonal antibody (M07), clone 4D5 View larger

SMUG1 monoclonal antibody (M07), clone 4D5

H00023583-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMUG1 monoclonal antibody (M07), clone 4D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SMUG1 monoclonal antibody (M07), clone 4D5

Brand: Abnova
Reference: H00023583-M07
Product name: SMUG1 monoclonal antibody (M07), clone 4D5
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMUG1.
Clone: 4D5
Isotype: IgG1 Kappa
Gene id: 23583
Gene name: SMUG1
Gene alias: FDG|HMUDG|MGC104370|UNG3
Gene description: single-strand-selective monofunctional uracil-DNA glycosylase 1
Genbank accession: BC000417.2
Immunogen: SMUG1 (AAH00417.1, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Protein accession: AAH00417.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023583-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023583-M07-13-15-1.jpg
Application image note: Western Blot analysis of SMUG1 expression in transfected 293T cell line by SMUG1 monoclonal antibody (M07), clone 4D5.

Lane 1: SMUG1 transfected lysate (Predicted MW: 19.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SMUG1 monoclonal antibody (M07), clone 4D5 now

Add to cart