Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCNDBP1 monoclonal antibody (M02), clone 3B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CCNDBP1 monoclonal antibody (M02), clone 3B7
| Brand: | Abnova |
| Reference: | H00023582-M02 |
| Product name: | CCNDBP1 monoclonal antibody (M02), clone 3B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCNDBP1. |
| Clone: | 3B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23582 |
| Gene name: | CCNDBP1 |
| Gene alias: | DIP1|GCIP |
| Gene description: | cyclin D-type binding-protein 1 |
| Genbank accession: | NM_012142 |
| Immunogen: | CCNDBP1 (NP_036274.2, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL |
| Protein accession: | NP_036274.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCNDBP1 expression in transfected 293T cell line by CCNDBP1 monoclonal antibody (M02), clone 3B7. Lane 1: CCNDBP1 transfected lysate(40.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |