DDAH1 monoclonal antibody (M01), clone 3F7 View larger

DDAH1 monoclonal antibody (M01), clone 3F7

H00023576-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDAH1 monoclonal antibody (M01), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DDAH1 monoclonal antibody (M01), clone 3F7

Brand: Abnova
Reference: H00023576-M01
Product name: DDAH1 monoclonal antibody (M01), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant DDAH1.
Clone: 3F7
Isotype: IgG2a Kappa
Gene id: 23576
Gene name: DDAH1
Gene alias: DDAH|FLJ21264|FLJ25539
Gene description: dimethylarginine dimethylaminohydrolase 1
Genbank accession: NM_012137
Immunogen: DDAH1 (NP_036269.1, 181 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
Protein accession: NP_036269.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023576-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023576-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged DDAH1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DDAH1 monoclonal antibody (M01), clone 3F7 now

Add to cart