Brand: | Abnova |
Reference: | H00023569-M01 |
Product name: | PADI4 monoclonal antibody (M01), clone 4D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PADI4. |
Clone: | 4D8 |
Isotype: | IgG2b Kappa |
Gene id: | 23569 |
Gene name: | PADI4 |
Gene alias: | PAD|PAD4|PADI5|PDI4|PDI5 |
Gene description: | peptidyl arginine deiminase, type IV |
Genbank accession: | NM_012387 |
Immunogen: | PADI4 (NP_004247, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL |
Protein accession: | NP_004247 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PADI4 is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |