Brand: | Abnova |
Reference: | H00023568-M03 |
Product name: | ARL2BP monoclonal antibody (M03), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARL2BP. |
Clone: | 2G6 |
Isotype: | IgG1 Kappa |
Gene id: | 23568 |
Gene name: | ARL2BP |
Gene alias: | BART|BART1 |
Gene description: | ADP-ribosylation factor-like 2 binding protein |
Genbank accession: | BC003087 |
Immunogen: | ARL2BP (AAH03087, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH |
Protein accession: | AAH03087 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARL2BP is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |