SNAPAP monoclonal antibody (M01), clone 3H1 View larger

SNAPAP monoclonal antibody (M01), clone 3H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAPAP monoclonal antibody (M01), clone 3H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about SNAPAP monoclonal antibody (M01), clone 3H1

Brand: Abnova
Reference: H00023557-M01
Product name: SNAPAP monoclonal antibody (M01), clone 3H1
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAPAP.
Clone: 3H1
Isotype: IgG1 Kappa
Gene id: 23557
Gene name: SNAPIN
Gene alias: SNAPAP
Gene description: SNAP-associated protein
Genbank accession: NM_012437
Immunogen: SNAPAP (NP_036569.1, 41 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Protein accession: NP_036569.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023557-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023557-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SNAPIN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNAPAP monoclonal antibody (M01), clone 3H1 now

Add to cart