SNAPIN purified MaxPab mouse polyclonal antibody (B01P) View larger

SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023557-B01P
Product name: SNAPIN purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SNAPIN protein.
Gene id: 23557
Gene name: SNAPIN
Gene alias: SNAPAP
Gene description: SNAP-associated protein
Genbank accession: BC004494
Immunogen: SNAPIN (AAH04494, 1 a.a. ~ 136 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Protein accession: AAH04494
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023557-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SNAPIN expression in transfected 293T cell line (H00023557-T02) by SNAPIN MaxPab polyclonal antibody.

Lane 1: SNAPAP transfected lysate(14.96 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNAPIN purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart