Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SNAPAP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SNAPAP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023557-A01 |
| Product name: | SNAPAP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SNAPAP. |
| Gene id: | 23557 |
| Gene name: | SNAPIN |
| Gene alias: | SNAPAP |
| Gene description: | SNAP-associated protein |
| Genbank accession: | NM_012437 |
| Immunogen: | SNAPAP (NP_036569.1, 41 a.a. ~ 136 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK |
| Protein accession: | NP_036569.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (10.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25.Yun HJ, Park J, Ho DH, Kim H, Kim CH, Oh H, Ga I, Seo H, Chang S, Son I, Seol W Exp Mol Med. 2013 Aug 16;45:e36. doi: 10.1038/emm.2013.68. |