HYAL4 monoclonal antibody (M03A), clone 1B10 View larger

HYAL4 monoclonal antibody (M03A), clone 1B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HYAL4 monoclonal antibody (M03A), clone 1B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HYAL4 monoclonal antibody (M03A), clone 1B10

Brand: Abnova
Reference: H00023553-M03A
Product name: HYAL4 monoclonal antibody (M03A), clone 1B10
Product description: Mouse monoclonal antibody raised against a partial recombinant HYAL4.
Clone: 1B10
Isotype: IgG2a Kappa
Gene id: 23553
Gene name: HYAL4
Gene alias: -
Gene description: hyaluronoglucosaminidase 4
Genbank accession: NM_012269
Immunogen: HYAL4 (NP_036401.1, 357 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS
Protein accession: NP_036401.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023553-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HYAL4 monoclonal antibody (M03A), clone 1B10 now

Add to cart