CCRK MaxPab rabbit polyclonal antibody (D01) View larger

CCRK MaxPab rabbit polyclonal antibody (D01)

H00023552-D01_100uL

New product

384,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCRK MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr,IP

More info about CCRK MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00023552-D01
Product name: CCRK MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CCRK protein.
Gene id: 23552
Gene name: CCRK
Gene alias: CDCH|p42
Gene description: cell cycle related kinase
Genbank accession: BC002655.2
Immunogen: CCRK (AAH02655.1, 1 a.a. ~ 275 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Protein accession: AAH02655.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00023552-D01-2-A0-1.jpg
Application image note: CCRK MaxPab rabbit polyclonal antibody. Western Blot analysis of CCRK expression in human kidney.
Applications: WB-Ce,WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CCRK MaxPab rabbit polyclonal antibody (D01) now

Add to cart